PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.10G251300.1.p
Common NameGLYMA_10G251300, LOC100787891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 779aa    MW: 86364.3 Da    PI: 6.5629
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.10G251300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-1775130156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rr+ t++t +q+ e+e++F+++++p++++r+ L ++lgL   q+k+WFqN+R++ k
  Glyma.10G251300.1.p  75 RRRHTRHTLHQISEMEAFFKECPHPDEKQRKALGRELGLVPLQIKFWFQNKRTQVK 130
                          7899************************************************9877 PP

2START1619.3e-513015146205
                          HHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
                START   6 aaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                          a +e +++ l+++p+Wv      e  n+de+l+ f+++ +      ++e +r +++v m +++lve l+d++ qW++++     +a t+e
  Glyma.10G251300.1.p 301 AVEEINQLTLSADPLWVPGNygsEVINEDEYLRHFPRGIGptllgARTESSRQTAIVMMHHMKLVEMLMDVN-QWSNMFCgivsRAVTHE 389
                          567888999999*****988888889***********999********************************.******999******** PP

                          EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEE CS
                START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtw 166
                          v+s g      ga+q+m+ae+q++splvp Rd +f+R+++++ + +w++vd+S d+ ++      v R +++pSg++i++++ng+skv+w
  Glyma.10G251300.1.p 390 VLSIGdharydGAYQVMSAEFQVPSPLVPtRDNYFIRFSKKHAGQSWAVVDISMDHLRPGA----VTRTRRRPSGCIIQELPNGYSKVIW 475
                          ***********************************************************98....8************************ PP

                          EE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 167 vehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          vehv++++  +h+l++ lv+s+la+gak+w a+ +r ce
  Glyma.10G251300.1.p 476 VEHVEVDDIEVHNLYKNLVNSTLAFGAKRWIAAIERTCE 514
                          ************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1959126IPR009057Homeodomain-like
SuperFamilySSF466891.75E-1768138IPR009057Homeodomain-like
PROSITE profilePS5007116.14772132IPR001356Homeobox domain
SMARTSM003895.6E-1774136IPR001356Homeobox domain
PfamPF000463.8E-1575130IPR001356Homeobox domain
CDDcd000861.37E-1675133No hitNo description
PROSITE profilePS5084834.478287518IPR002913START domain
CDDcd088753.16E-93291514No hitNo description
SMARTSM002341.8E-43296515IPR002913START domain
PfamPF018522.0E-42302514IPR002913START domain
SuperFamilySSF559611.24E-25350516No hitNo description
Gene3DG3DSA:3.30.530.207.7E-4362510IPR023393START-like domain
SuperFamilySSF559611.65E-18536770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MYNKSQNTKF DSQQQQQQQQ PQQQQPQNLM EMSTQRTSSE GRNRDDQEPA AGNEVTMEAP  60
PSGDEDQDPD EGFKRRRHTR HTLHQISEME AFFKECPHPD EKQRKALGRE LGLVPLQIKF  120
WFQNKRTQVK SQQERYENNL LRVENDKLRA ENSRYRNALS NTSCPNCGAP TTLGEMSFDE  180
QQLRMENARQ KEEIDSMSGL AAKYAAGKSA SNSYYNMPSN QNQMPSRSLD LGVVNNNSSI  240
NNNNSSINNS NNKNNNNNNY IVQAQPVAMV GEMYGGNDPL RELPLLSSFD KDLISEIGLV  300
AVEEINQLTL SADPLWVPGN YGSEVINEDE YLRHFPRGIG PTLLGARTES SRQTAIVMMH  360
HMKLVEMLMD VNQWSNMFCG IVSRAVTHEV LSIGDHARYD GAYQVMSAEF QVPSPLVPTR  420
DNYFIRFSKK HAGQSWAVVD ISMDHLRPGA VTRTRRRPSG CIIQELPNGY SKVIWVEHVE  480
VDDIEVHNLY KNLVNSTLAF GAKRWIAAIE RTCEHLARAM ATNIPQGALC VITSHEGRKS  540
MMKLAERMVL SFSTGVGAST ANAWTPLPLD LENVRVMTRK SVDDPGRPSG IVLSAATSLW  600
LPVPARRVFD FLRSENTRNQ VWDILSSGAQ VNELAHIAKG RDHGNSVSLL RVNTQNVAQN  660
NMLILQESCI DATGSFVVYA PIDLASMNLV LGGGNPDYVA LLPSGFAVLP DGPALNVVPG  720
PVCEVVGSGR GCLLTVAFQI LVDSTPTAKL SVGSVTTVNN LIKRTVERIK DSVTLDGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006589606.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X1
RefseqXP_006589607.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X1
RefseqXP_006589605.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform X1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLA0A0R0HYQ30.0A0A0R0HYQ3_SOYBN; Uncharacterized protein
STRINGGLYMA10G39720.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2237224
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein